Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OLFR187 Peptide - C-terminal region

OLFR187 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MOR183-8

UniProt

Q8VEX6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VHPASSEVDDQDMIDSLFYTVIIPVLNPIIYSLRNKQVIDSLAKFLKRNV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPAT4 Human Gene Knockout Kit (CRISPR)
KN208614BN 1 Kit

GPAT4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon: right
CS632565 5x 5 µm

Frozen Tissue Sections, Colon: right

Sign In for Pricing
View Details
Human Angiogenin Recombinant Rabbit monoclonal Antibody
HA725076 100 µL

Human Angiogenin Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Angiotensin II Trifluoroacetic Acid Salt (Human)
TRC-A637965-1MG 1 mg

Angiotensin II Trifluoroacetic Acid Salt (Human)

Sign In for Pricing
View Details
RNS10 (RNASE10) (NM_001012975) Human Over-expression Lysate
LC422938 20 µg

RNS10 (RNASE10) (NM_001012975) Human Over-expression Lysate

Sign In for Pricing
View Details
MVD (NM_002461) Human Over-expression Lysate
LY419305 100 µg

MVD (NM_002461) Human Over-expression Lysate

Sign In for Pricing
View Details