Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OLFR187 Peptide - C-terminal region

OLFR187 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MOR183-8

UniProt

Q8VEX6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VHPASSEVDDQDMIDSLFYTVIIPVLNPIIYSLRNKQVIDSLAKFLKRNV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CENPF Polyclonal Antibody
E-AB-16336-01 20 µL

CENPF Polyclonal Antibody

Sign In for Pricing
View Details
CENPF Polyclonal Antibody
E-AB-16336-02 60 µL

CENPF Polyclonal Antibody

Sign In for Pricing
View Details
CENPF Polyclonal Antibody
E-AB-16336-03 120 µL

CENPF Polyclonal Antibody

Sign In for Pricing
View Details
CENPF Polyclonal Antibody
E-AB-16336-04 200 µL

CENPF Polyclonal Antibody

Sign In for Pricing
View Details
Anti-IQUB
Y058883 100 µg

Anti-IQUB

Sign In for Pricing
View Details
LY6E (NM_001127213) Human Over-expression Lysate
LY426714 100 µg

LY6E (NM_001127213) Human Over-expression Lysate

Sign In for Pricing
View Details