What is the catalog number for OLFR142 Peptide - C-terminal region?

The catalog number for OLFR142 Peptide - C-terminal region is orb1998202.

What sizes are available for OLFR142 Peptide - C-terminal region?

OLFR142 Peptide - C-terminal region is available in the following size(s): 100 µg.

Is OLFR142 Peptide - C-terminal region in stock?

OLFR142 Peptide - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

OLFR142 Peptide - C-terminal region

Product Specifications

Product Name Alternative

K20, MOR227-2

UniProt

Q60881

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_667195.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YMRPSSTFTEDKLVSVFYTVITPMLNPIVYTLRNTEMKNAIRMSWKQKDS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

02290 00500 500 g

Selenium Dioxide (sublimed) 99% Extrapure

Sign In for Pricing

View Details

orb2546734 100 µL

CEBP gamma Rabbit Polyclonal Antibody (BF594)

Sign In for Pricing

View Details

orb2523234 100 µL

Ecat1 Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing

View Details

GTR15194587 1 Vial

Lentiviral mouse Mpeg1 shRNA (UAS) - Lentiviral mouse Mpeg1 shRNA (UAS) plasmid

Sign In for Pricing

View Details

E10G34474 100 µL

PRRT2 Rabbit Polyclonal Antibody

Sign In for Pricing

View Details

sc-38319-PR 10 µM - 20 µL

SF2/ASF (h) -PR

Sign In for Pricing

View Details