Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OLFR142 Peptide - C-terminal region

OLFR142 Peptide - C-terminal region

Product Specifications

Product Name Alternative

K20, MOR227-2

UniProt

Q60881

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_667195.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YMRPSSTFTEDKLVSVFYTVITPMLNPIVYTLRNTEMKNAIRMSWKQKDS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monoclonal IL8 Antibody
AMM03127G 0.1ml

Monoclonal IL8 Antibody

Sign In for Pricing
View Details
Olr802 Protein Vector (Rat) (pPB-C-His)
PV291198 500 ng

Olr802 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
TRP7 Recombinant Protein Antigen
NBP1-87523PEP 0.1 mL

TRP7 Recombinant Protein Antigen

Sign In for Pricing
View Details
LMP7 (A-12) Alexa Fluor® 647
sc-365699 AF647 200 µg/mL

LMP7 (A-12) Alexa Fluor® 647

Sign In for Pricing
View Details
Armcx6 sgRNA CRISPR Lentivector set (Rat)
K7410201 3x 1.0 µg

Armcx6 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
DRM1A Antibody
orb839396 2 mg

DRM1A Antibody

Sign In for Pricing
View Details