OLFR481 Peptide - C-terminal region
OLFR481 Peptide - C-terminal region
Product Specifications
Product Name Alternative
MOR204-2, MOR204-39
UniProt
Q8VGI5
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_667136.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: MPKSSYSADQVKVASVVYTVVIPMLNPLIYSLRNKEVKEAMKKLMARTHW
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
RA0195-C.5 0.5 mL
Ep-CAM / CD326 (Epithelial Marker) ; Clone VU-1D9 (Concentrate)
Sign In for Pricing
View Details bs-7729R-BF594 100 µL
SMC5 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
Sign In for Pricing
View Details 
bs-11450R-PE-Cy7 100 µL
AMIGO2 Polyclonal Antibody, PE-Cy7 Conjugated
Sign In for Pricing
View Details