Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OLFR481 Peptide - C-terminal region

OLFR481 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MOR204-2, MOR204-39

UniProt

Q8VGI5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_667136.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MPKSSYSADQVKVASVVYTVVIPMLNPLIYSLRNKEVKEAMKKLMARTHW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

8-Bromoguanosine-13C,15N2
HY-W767371 1 Each

8-Bromoguanosine-13C,15N2

Sign In for Pricing
View Details
PKC delta Rabbit mAb
MBS4752962-01 0.1 mL

PKC delta Rabbit mAb

Sign In for Pricing
View Details
PKC delta Rabbit mAb
MBS4752962-02 5x 0.1 mL

PKC delta Rabbit mAb

Sign In for Pricing
View Details
CATIP Antibody - middle region
MBS3212262-01 0.1 mL

CATIP Antibody - middle region

Sign In for Pricing
View Details
CATIP Antibody - middle region
MBS3212262-02 5x 0.1 mL

CATIP Antibody - middle region

Sign In for Pricing
View Details
POLR2E Polyclonal Antibody
A60334-100 100 µL

POLR2E Polyclonal Antibody

Sign In for Pricing
View Details