Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OLFR470 Peptide - C-terminal region

OLFR470 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MOR204-22

UniProt

Q8VF66

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_666636.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MPKSSYSTDQNKVVSVFYTVVIPMLNPIIYSLRNNEIKGALKRQLARKIF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PACSIN2 (Protein Kinase C and Casein Kinase Substrate in Neurons Protein 2, Syndapin 2, Syndapin-II, SDPII) (HRP)
130814-HRP 100 µL

PACSIN2 (Protein Kinase C and Casein Kinase Substrate in Neurons Protein 2, Syndapin 2, Syndapin-II, SDPII) (HRP)

Sign In for Pricing
View Details
PAX7 (Paired Box 7, HUP1, PAX7B) (PE)
MBS6184851-01 0.1 mL

PAX7 (Paired Box 7, HUP1, PAX7B) (PE)

Sign In for Pricing
View Details
PAX7 (Paired Box 7, HUP1, PAX7B) (PE)
MBS6184851-02 5x 0.1 mL

PAX7 (Paired Box 7, HUP1, PAX7B) (PE)

Sign In for Pricing
View Details
Anti-FGF2 Antibody (Capture)
MBS8327381-01 0.1 mg

Anti-FGF2 Antibody (Capture)

Sign In for Pricing
View Details
Anti-FGF2 Antibody (Capture)
MBS8327381-02 1 mg

Anti-FGF2 Antibody (Capture)

Sign In for Pricing
View Details
Anti-FGF2 Antibody (Capture)
MBS8327381-03 5x 1 mg

Anti-FGF2 Antibody (Capture)

Sign In for Pricing
View Details