Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OLFR470 Peptide - C-terminal region

OLFR470 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MOR204-22

UniProt

Q8VF66

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_666636.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MPKSSYSTDQNKVVSVFYTVVIPMLNPIIYSLRNNEIKGALKRQLARKIF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SERBP1 Antibody
orb1319075-01 30 µL

SERBP1 Antibody

Sign In for Pricing
View Details
SERBP1 Antibody
orb1319075-02 50 μL

SERBP1 Antibody

Sign In for Pricing
View Details
SERBP1 Antibody
orb1319075-03 100 µL

SERBP1 Antibody

Sign In for Pricing
View Details
Human OPTC qPCR Primer Pair
QH37697S 200 Tests

Human OPTC qPCR Primer Pair

Sign In for Pricing
View Details
CFLAR, 1-480aa, Human, E Coli (Denatured)
MBS204747-01 0.02 mg

CFLAR, 1-480aa, Human, E Coli (Denatured)

Sign In for Pricing
View Details
CFLAR, 1-480aa, Human, E Coli (Denatured)
MBS204747-02 0.1 mg

CFLAR, 1-480aa, Human, E Coli (Denatured)

Sign In for Pricing
View Details