OLFR139 Peptide - C-terminal region
OLFR139 Peptide - C-terminal region
Product Specifications
Product Name Alternative
M5, MOR255-2
UniProt
Q60891
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_667214.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LGSVSASDKDKGIGILNTILSPMLNPLIYSLRNPDVQGALKRVLTGKRYP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
10570020-AAT 100 Tests
IFluor® 405 Anti-human CD57 Antibody *HI57a*
Sign In for Pricing
View Details 
orb3106671 100 µg
MEK5/MAP2K5 Rabbit Polyclonal Antibody (Fluoro594)
Sign In for Pricing
View Details 
GTR15282390 1 Vial
Lentiviral mouse Itih5 shRNA (UAS) - Lentiviral mouse Itih5 shRNA (UAS) (100)
Sign In for Pricing
View Details