Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OLFR139 Peptide - C-terminal region

OLFR139 Peptide - C-terminal region

Product Specifications

Product Name Alternative

M5, MOR255-2

UniProt

Q60891

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_667214.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LGSVSASDKDKGIGILNTILSPMLNPLIYSLRNPDVQGALKRVLTGKRYP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MEIS1 Antibody
orb1314663 100 µL

MEIS1 Antibody

Sign In for Pricing
View Details
Rat SLC22A12 shRNA Plasmid
abx990623-01 150 µg

Rat SLC22A12 shRNA Plasmid

Sign In for Pricing
View Details
Rat SLC22A12 shRNA Plasmid
abx990623-02 300 µg

Rat SLC22A12 shRNA Plasmid

Sign In for Pricing
View Details
NEK1 Antibody
C44965-01 50 µL

NEK1 Antibody

Sign In for Pricing
View Details
NEK1 Antibody
C44965-02 100 µL

NEK1 Antibody

Sign In for Pricing
View Details
PARP-1 (human), (recombinant) (high purity) (His-tag)
MBS566075-01 0.01 mg

PARP-1 (human), (recombinant) (high purity) (His-tag)

Sign In for Pricing
View Details