Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STK-PS2 Peptide - C-terminal region

STK-PS2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Gm4776, EG212225, 4930509O22

UniProt

Q8C0V7

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

BAC26584.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CDMETPSPPQKISRFKRMSKRIRACLAQLCCIPRAPRTKKKHTSSNKIAP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

bPiDDB
TRC-P991823-1MG 1 mg

bPiDDB

Sign In for Pricing
View Details
Human LGALS9B activation kit by CRISPRa
GA117105 1 Kit

Human LGALS9B activation kit by CRISPRa

Sign In for Pricing
View Details
Peroxiredoxin-5 Antibody
KC-1126-01 50 μL

Peroxiredoxin-5 Antibody

Sign In for Pricing
View Details
Peroxiredoxin-5 Antibody
KC-1126-02 100 µL

Peroxiredoxin-5 Antibody

Sign In for Pricing
View Details
Peroxiredoxin-5 Antibody
KC-1126-03 1 mL

Peroxiredoxin-5 Antibody

Sign In for Pricing
View Details
Slc25a28 Mouse Gene Knockout Kit (CRISPR)
KN515974 1 Kit

Slc25a28 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details