Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OLFR474 Peptide - C-terminal region

OLFR474 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MOR204-20

UniProt

Q8VFC9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_666706.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ITFIYVMPKSNYSTEKNKVLSEFYTVVIPMLNHLIYSLKNRDVKDALRKA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gm6927 Recombinant Protein (Mouse)
RP138560 100 µg

Gm6927 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
IL6 (Interleukin 6 (Interferon, beta 2), BSF2, HGF, HSF, IFNB2, IL-6) (MaxLight 550)
247606-ML550 100 µL

IL6 (Interleukin 6 (Interferon, beta 2), BSF2, HGF, HSF, IFNB2, IL-6) (MaxLight 550)

Sign In for Pricing
View Details
DCST2 shRNA Plasmid (m)
sc-142906-SH 20 µg

DCST2 shRNA Plasmid (m)

Sign In for Pricing
View Details
Histone H2A (Butyryl-K5) polyclonal antibody
BS67377 50ul

Histone H2A (Butyryl-K5) polyclonal antibody

Sign In for Pricing
View Details
Anti-VEGFR2/KDR Antibody-APC (8D594)
TMAY-03510A-01 25 Tests

Anti-VEGFR2/KDR Antibody-APC (8D594)

Sign In for Pricing
View Details
Anti-VEGFR2/KDR Antibody-APC (8D594)
TMAY-03510A-02 100 Tests

Anti-VEGFR2/KDR Antibody-APC (8D594)

Sign In for Pricing
View Details