Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OLFR472 Peptide - C-terminal region

OLFR472 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MOR204-5

UniProt

Q8VG43

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_666985.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VMPKSSYSTEQNKVISLFYTVVIPMLNPLIYSLRNRDVKDALRKAIVRVY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NF-M Recombinant Chimeric Antibody Antibody
HA601507 100 µL

NF-M Recombinant Chimeric Antibody Antibody

Sign In for Pricing
View Details
7-(4-Chlorobutoxy)quinolin-2(1H)-one
TRC-C381343-2.5G 2.5 g

7-(4-Chlorobutoxy)quinolin-2(1H)-one

Sign In for Pricing
View Details
SN38 Recombinant Rabbit Monoclonal Antibody [PSH0-06]
HA721259 100 µL

SN38 Recombinant Rabbit Monoclonal Antibody [PSH0-06]

Sign In for Pricing
View Details
Vil1 Mouse Gene Knockout Kit (CRISPR)
KN518889 1 Kit

Vil1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ethyl Imidazole-2-carboxylate
TRC-E919195-2.5G 2.5 g

Ethyl Imidazole-2-carboxylate

Sign In for Pricing
View Details
RNF133 Antibody
KC-1887-01 50 μL

RNF133 Antibody

Sign In for Pricing
View Details