Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OLFR472 Peptide - C-terminal region

OLFR472 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MOR204-5

UniProt

Q8VG43

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_666985.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VMPKSSYSTEQNKVISLFYTVVIPMLNPLIYSLRNRDVKDALRKAIVRVY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Ovary: bilateral
CS503370 5x 5 µm

Frozen Tissue Sections, Ovary: bilateral

Sign In for Pricing
View Details
Factor XIIIa (Coagulation Factor XIIIA Chain) (F13A1/1683), CF594 conjugate, 0.1mg/mL
BNC941683-100 1x 100 µL

Factor XIIIa (Coagulation Factor XIIIA Chain) (F13A1/1683), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse Dapk1 activation kit by CRISPRa
GA208254 1 Kit

Mouse Dapk1 activation kit by CRISPRa

Sign In for Pricing
View Details
Zdhhc23 Mouse Gene Knockout Kit (CRISPR)
KN519688 1 Kit

Zdhhc23 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
UBE2V1 (TMEM189-UBE2V1) (NM_199203) Human Recombinant Protein
TP323133 20 µg

UBE2V1 (TMEM189-UBE2V1) (NM_199203) Human Recombinant Protein

Sign In for Pricing
View Details
SHISAL1 Human Gene Knockout Kit (CRISPR)
KN419322 1 Kit

SHISAL1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details