Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VMN1R41 Peptide - middle region

VMN1R41 Peptide - middle region

Product Specifications

Product Name Alternative

V1rb9, V1ra12

UniProt

Q9WUF1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_444460.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NVLWTITLSPRSSCLTKFKHKSPHHISGAFLFFCALYMSFSSHLFLSIIA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bis (pentafluorophenyl) phenylphosphine
267127-01 100 mg

Bis (pentafluorophenyl) phenylphosphine

Sign In for Pricing
View Details
Bis (pentafluorophenyl) phenylphosphine
267127-02 250 mg

Bis (pentafluorophenyl) phenylphosphine

Sign In for Pricing
View Details
Bis (pentafluorophenyl) phenylphosphine
267127-03 500 mg

Bis (pentafluorophenyl) phenylphosphine

Sign In for Pricing
View Details
Bis (pentafluorophenyl) phenylphosphine
267127-04 1 g

Bis (pentafluorophenyl) phenylphosphine

Sign In for Pricing
View Details
Bis (pentafluorophenyl) phenylphosphine
267127-05 2 g

Bis (pentafluorophenyl) phenylphosphine

Sign In for Pricing
View Details
Anti-Crithidia fasciculata GP63_adherent Antibody, Cy3 Conjugate
DZ41320-Cy3 200 µL/Vial

Anti-Crithidia fasciculata GP63_adherent Antibody, Cy3 Conjugate

Sign In for Pricing
View Details