VMN1R41 Peptide - middle region
VMN1R41 Peptide - middle region
Product Specifications
Product Name Alternative
V1rb9, V1ra12
UniProt
Q9WUF1
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_444460.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: NVLWTITLSPRSSCLTKFKHKSPHHISGAFLFFCALYMSFSSHLFLSIIA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15341033 1 Vial
Lentiviral human OAZ1 shRNA (UAS) - Lentiviral human OAZ1 shRNA (UAS, iRFP) (25)
Sign In for Pricing
View Details 
BOC122032M Pack of 1000
Pack of 1000 Cellulose Stoppers 12X20X32 Mm
Sign In for Pricing
View Details 
GTR15116863 1 Vial
Lentiviral human PCDHGA4 shRNA (UAS) - Lentiviral human PCDHGA4 shRNA (UAS) plasmid
Sign In for Pricing
View Details