Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRGPRA5 Peptide - N-terminal region

MRGPRA5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MrgA5

UniProt

Q91ZC7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_997417.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DKPLWKYGHLDSDPKLMIIIFRLVGMTGNAIVFWLLGFSLHRNAFSVYIL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NLRP3 Human Gene Knockout Kit (CRISPR)
KN213623 1 Kit

NLRP3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
AMACR (NM_001167595) Human Over-expression Lysate
LC432989 20 µg

AMACR (NM_001167595) Human Over-expression Lysate

Sign In for Pricing
View Details
2'-Deoxyadenosine Monohydrate
TRC-D231620-250MG 250 mg

2'-Deoxyadenosine Monohydrate

Sign In for Pricing
View Details
ERCC1 / RAD10 (Tumor Progression Marker) (ERCC1/2318), CF740 conjugate, 0.1mg/mL
BNC742318-500 1x 500 µL

ERCC1 / RAD10 (Tumor Progression Marker) (ERCC1/2318), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Green Fluorescent FAM-FLICA® Caspase-6 (VEID) Assay Kit
95 25 Tests

Green Fluorescent FAM-FLICA® Caspase-6 (VEID) Assay Kit

Sign In for Pricing
View Details
PCDHB15 Antibody
KC-30443-01 50 μL

PCDHB15 Antibody

Sign In for Pricing
View Details