Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRGPRA5 Peptide - N-terminal region

MRGPRA5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MrgA5

UniProt

Q91ZC7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_997417.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DKPLWKYGHLDSDPKLMIIIFRLVGMTGNAIVFWLLGFSLHRNAFSVYIL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SOX4 (Master Regulator of Epithelial-Mesenchymal Transition) (SOX4/2540), CF640R conjugate, 0.1mg/mL
BNC402540-500 1x 500 µL

SOX4 (Master Regulator of Epithelial-Mesenchymal Transition) (SOX4/2540), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GASK1A Rabbit Polyclonal Antibody
TA372310 100 µL

GASK1A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue Total RNA, Kidney
CR560913 5 µg

Tissue Total RNA, Kidney

Sign In for Pricing
View Details
Guaiacol-b-D-glucopyranoside
TRC-G245565-50MG 50 mg

Guaiacol-b-D-glucopyranoside

Sign In for Pricing
View Details
FITC Anti-Human CD80 Antibody[2F4]
E-AB-F1365C-01 20 Tests

FITC Anti-Human CD80 Antibody[2F4]

Sign In for Pricing
View Details
FITC Anti-Human CD80 Antibody[2F4]
E-AB-F1365C-02 100 Tests

FITC Anti-Human CD80 Antibody[2F4]

Sign In for Pricing
View Details