Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OLFR5 Peptide - C-terminal region

OLFR5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ORL120, MOR103-8

UniProt

Q60889

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_667125.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IYARPKRIEAMDLNKVLSVIYTVVTPMCNPVIYCLRNKEVQVALHRTMHW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

METTL25B Knockout Hela Polyclonal Cells
ARG8407 1 Million

METTL25B Knockout Hela Polyclonal Cells

Sign In for Pricing
View Details
Rabbit anti-Shigella flexneri BARA Polyclonal Antibody
MBS7161016 Inquire

Rabbit anti-Shigella flexneri BARA Polyclonal Antibody

Sign In for Pricing
View Details
RSAD2 Human Pre-designed siRNA Set A
HY-RS12297 1 Set

RSAD2 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
BCL2A1 Protein Vector (Human) (pPM-C-HA)
13226021 500 ng

BCL2A1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
HEYL (Hairy/Enhancer-of-Split Related with YRPW Motif-like, HRT3, MGC12623, bHLHb33) (MaxLight 550)
247051-ML550 100 µL

HEYL (Hairy/Enhancer-of-Split Related with YRPW Motif-like, HRT3, MGC12623, bHLHb33) (MaxLight 550)

Sign In for Pricing
View Details
Mouse Zc3h11a (NM_144530) AAV Particle
MR210681A1V 250 µL

Mouse Zc3h11a (NM_144530) AAV Particle

Sign In for Pricing
View Details