What is the catalog number for OLFR5 Peptide - C-terminal region?

The catalog number for OLFR5 Peptide - C-terminal region is orb1998186.

What sizes are available for OLFR5 Peptide - C-terminal region?

OLFR5 Peptide - C-terminal region is available in the following size(s): 100 µg.

Is OLFR5 Peptide - C-terminal region in stock?

OLFR5 Peptide - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

OLFR5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ORL120, MOR103-8

UniProt

Q60889

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_667125.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IYARPKRIEAMDLNKVLSVIYTVVTPMCNPVIYCLRNKEVQVALHRTMHW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NBP3-26935CL1 0.1 mL

Mouse Monoclonal alpha 1-Microglobulin Antibody (AMBP/4533) [CoraFluor 1]

Sign In for Pricing

View Details

mm31657 500 ng

LentimiRa-Off-mmu-miR-7055-5p Vector

Sign In for Pricing

View Details

MBS674161-01 100 Tests

Mouse Anti-Human CD106/VCAM-1-PE

Sign In for Pricing

View Details

MBS674161-02 5x 100 Tests

Mouse Anti-Human CD106/VCAM-1-PE

Sign In for Pricing

View Details

QP11162-5ug 5ug

Recombinant Human BIN1 Protein, His, E.coli-5ug

Sign In for Pricing

View Details

MBS8224218-01 0.03 mL

Anti-Apolipoprotein C3 Antibody

Sign In for Pricing

View Details