Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OLFR9 Peptide - C-terminal region

OLFR9 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MOR269-3

UniProt

Q60885

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_667072.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QADSFGNTDQILTLVYTVVTPMCNPFVYSLRNKEVTGAMRRLMKRYLWGP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Erythorbic Acid
MBS5758829 Inquire

Erythorbic Acid

Sign In for Pricing
View Details
CCDC36 AAV Vector (Mouse) (CMV)
15257104 1 µg

CCDC36 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
Tegoprazan 10mg
A20873-10 10 mg

Tegoprazan 10mg

Sign In for Pricing
View Details
UBXN6, CT (UBXN6, UBXD1, UBXDC2, UBX domain-containing protein 6, UBX domain-containing protein 1) (AP) discontinued
043560-AP 200 µL

UBXN6, CT (UBXN6, UBXD1, UBXDC2, UBX domain-containing protein 6, UBX domain-containing protein 1) (AP) discontinued

Sign In for Pricing
View Details
Methyl (R) -5-amino-2,3-dihydro-1H-indene-2-carboxylate hydrochloride
OR1103214-01 50 mg

Methyl (R) -5-amino-2,3-dihydro-1H-indene-2-carboxylate hydrochloride

Sign In for Pricing
View Details
Methyl (R) -5-amino-2,3-dihydro-1H-indene-2-carboxylate hydrochloride
OR1103214-02 100 mg

Methyl (R) -5-amino-2,3-dihydro-1H-indene-2-carboxylate hydrochloride

Sign In for Pricing
View Details