What is the catalog number for OLFR9 Peptide - C-terminal region?

The catalog number for OLFR9 Peptide - C-terminal region is orb1998185.

What sizes are available for OLFR9 Peptide - C-terminal region?

OLFR9 Peptide - C-terminal region is available in the following size(s): 100 µg.

Is OLFR9 Peptide - C-terminal region in stock?

OLFR9 Peptide - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

OLFR9 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MOR269-3

UniProt

Q60885

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_667072.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QADSFGNTDQILTLVYTVVTPMCNPFVYSLRNKEVTGAMRRLMKRYLWGP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PVT65857 2 µg

PCMV-TRIM65-3xFLAG-Neo Plasmid

Sign In for Pricing

View Details

NB100-91761V 0.1 mL

Rabbit Polyclonal Factor VIII Antibody [DyLight 405]

Sign In for Pricing

View Details

K2790005 3x 1.0 µg

OSCP1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing

View Details

HY-B1620C-01 100 g

Polyvinylpyrrolidone K17

Sign In for Pricing

View Details

HY-B1620C-02 500 g

Polyvinylpyrrolidone K17

Sign In for Pricing

View Details

HY-B1620C-03 1 Kg

Polyvinylpyrrolidone K17

Sign In for Pricing

View Details