Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OLFR490 Peptide - C-terminal region

OLFR490 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MOR204-17

UniProt

Q8VFD2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_666709.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PKSSYSMDQNKIISVFYMVVVPMLNPLIYSLRNNEIKGALKRHFDRKTFS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRPF40B (NM_001031698) Human Recombinant Protein
TP309144M 100 µg

PRPF40B (NM_001031698) Human Recombinant Protein

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (MUC1/520), CF647 conjugate, 0.1mg/mL
BNC470520-100 1x 100 µL

Mucin 1 / EMA / Episialin / CD227 (MUC1/520), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Mouse LIGHT protein (His Tag)
PKSM041487-01 20 µg

Recombinant Mouse LIGHT protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse LIGHT protein (His Tag)
PKSM041487-02 100 µg

Recombinant Mouse LIGHT protein (His Tag)

Sign In for Pricing
View Details
p53 (TP53) (C-term) Rabbit Polyclonal Antibody
AP13241PU-N 400 µL

p53 (TP53) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (IGHM/3776R), CF647 conjugate, 0.1mg/mL
BNC473776-100 1x 100 µL

Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (IGHM/3776R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details