Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OLFR490 Peptide - C-terminal region

OLFR490 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MOR204-17

UniProt

Q8VFD2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_666709.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PKSSYSMDQNKIISVFYMVVVPMLNPLIYSLRNNEIKGALKRHFDRKTFS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guanylate kinase (GUK1) (NM_000858) Human Over-expression Lysate
LY400303 100 µg

Guanylate kinase (GUK1) (NM_000858) Human Over-expression Lysate

Sign In for Pricing
View Details
Dihydropyrimidinase (DPYS) (NM_001385) Human Over-expression Lysate
LC419991 20 µg

Dihydropyrimidinase (DPYS) (NM_001385) Human Over-expression Lysate

Sign In for Pricing
View Details
OR5F1 Human Gene Knockout Kit (CRISPR)
KN421057 1 Kit

OR5F1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
LGALS16 (NM_001190441) Human Over-expression Lysate
LY433981 100 µg

LGALS16 (NM_001190441) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human CCDC134 Protein (His Tag)
PKSH032266-01 10 µg

Recombinant Human CCDC134 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human CCDC134 Protein (His Tag)
PKSH032266-02 50 µg

Recombinant Human CCDC134 Protein (His Tag)

Sign In for Pricing
View Details