Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OLFR478 Peptide - C-terminal region

OLFR478 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MOR204-13

UniProt

Q8VG04

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_666945.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IYVMPKSSFSTDQNKVVSVFYMVVIPMLNPLIYSLRNNEIKGALKRQIGR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Mouse NCOR1 (KIAA1047), Rabbit Polyclonal
MKA1047PA Inquire

Anti-Mouse NCOR1 (KIAA1047), Rabbit Polyclonal

Sign In for Pricing
View Details
MRT4 Homolog, Ribosome Maturation Factor (MRTO4) Antibody
abx235367 100 µg

MRT4 Homolog, Ribosome Maturation Factor (MRTO4) Antibody

Sign In for Pricing
View Details
CDC37 Rabbit Polyclonal Antibody
APRab00129-01 20 µL

CDC37 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CDC37 Rabbit Polyclonal Antibody
APRab00129-02 50 µL

CDC37 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CDC37 Rabbit Polyclonal Antibody
APRab00129-03 100 µL

CDC37 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CDC37 Rabbit Polyclonal Antibody
APRab00129-04 200 µL

CDC37 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details