Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OLFR478 Peptide - C-terminal region

OLFR478 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MOR204-13

UniProt

Q8VG04

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_666945.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IYVMPKSSFSTDQNKVVSVFYMVVIPMLNPLIYSLRNNEIKGALKRQIGR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-hnRNP L Antibody
CPA7066-01 30 µL

Anti-hnRNP L Antibody

Sign In for Pricing
View Details
Anti-hnRNP L Antibody
CPA7066-02 50 μL

Anti-hnRNP L Antibody

Sign In for Pricing
View Details
Anti-hnRNP L Antibody
CPA7066-03 100 µL

Anti-hnRNP L Antibody

Sign In for Pricing
View Details
Anti-hnRNP L Antibody
CPA7066-04 200 µL

Anti-hnRNP L Antibody

Sign In for Pricing
View Details
MetRS Rabbit Monoclonal Antibody
E10G21659 100 µL

MetRS Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
hsa-miR-1197 miRNA Agomir
MBS8311519-01 5 nmol

hsa-miR-1197 miRNA Agomir

Sign In for Pricing
View Details