Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OLFR478 Peptide - C-terminal region

OLFR478 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MOR204-13

UniProt

Q8VG04

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_666945.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IYVMPKSSFSTDQNKVVSVFYMVVIPMLNPLIYSLRNNEIKGALKRQIGR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RecO Antibody (FITC)
orb28485-01 50 µg

RecO Antibody (FITC)

Sign In for Pricing
View Details
RecO Antibody (FITC)
orb28485-02 100 µg

RecO Antibody (FITC)

Sign In for Pricing
View Details
Rabbit Polyclonal EMAP-II/AIMP1 Antibody [Alexa Fluor 488]
NBP2-98343AF488 0.1 mL

Rabbit Polyclonal EMAP-II/AIMP1 Antibody [Alexa Fluor 488]

Sign In for Pricing
View Details
mmu-miR-216c-3p miRNA Agomir
MBS8315120-01 5 nmol

mmu-miR-216c-3p miRNA Agomir

Sign In for Pricing
View Details
mmu-miR-216c-3p miRNA Agomir
MBS8315120-02 10 nmol

mmu-miR-216c-3p miRNA Agomir

Sign In for Pricing
View Details
mmu-miR-216c-3p miRNA Agomir
MBS8315120-03 20 nmol

mmu-miR-216c-3p miRNA Agomir

Sign In for Pricing
View Details