Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OLFR476 Peptide - C-terminal region

OLFR476 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MOR204-3

UniProt

Q8VGI6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_667135.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ITFIYVMPKSNYSTAQNKILSVFYTVVIPMLNPLIYSLRNRDVKEALRKA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(3b)-3-(3-Azidopropoxy)solanid-5-ene
TRC-S064550-5MG 5 mg

(3b)-3-(3-Azidopropoxy)solanid-5-ene

Sign In for Pricing
View Details
Benzaldehyde-(phenyl-13C6)
TRC-B183897-50MG 50 mg

Benzaldehyde-(phenyl-13C6)

Sign In for Pricing
View Details
SOX2 (Transcription Factor) (SOX2/1791), CF740 conjugate, 0.1mg/mL
BNC741791-100 1x 100 µL

SOX2 (Transcription Factor) (SOX2/1791), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mad2L2 Recombinant Rabbit Monoclonal Antibody [JU99-23]
ET1706-38 100 µL

Mad2L2 Recombinant Rabbit Monoclonal Antibody [JU99-23]

Sign In for Pricing
View Details
Prolactin (Pituitary Tumor Marker) (PRL/2642), CF594 conjugate, 0.1mg/mL
BNC942642-500 1x 500 µL

Prolactin (Pituitary Tumor Marker) (PRL/2642), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ERK1 Antibody
KC-4219-01 50 μL

ERK1 Antibody

Sign In for Pricing
View Details