Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDNF Peptide - middle region

GDNF Peptide - middle region

Product Specifications

Product Name Alternative

ATF1, ATF2, HSCR3, HFB1-GDNF

UniProt

P39905

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_000505.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ATIKRLKRSPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Escherichia coli O157:H7 YCJF Polyclonal Antibody
MBS9004098 Inquire

Rabbit anti-Escherichia coli O157:H7 YCJF Polyclonal Antibody

Sign In for Pricing
View Details
AGRP sgRNA CRISPR Lentivector (Human) (Target 1)
K0059602 1.0 µg DNA

AGRP sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Recombinant Human LIM domain-binding protein 3 (LDB3)
MBS1042732-01 0.02 mg (E-Coli)

Recombinant Human LIM domain-binding protein 3 (LDB3)

Sign In for Pricing
View Details
Recombinant Human LIM domain-binding protein 3 (LDB3)
MBS1042732-02 0.1 mg (E-Coli)

Recombinant Human LIM domain-binding protein 3 (LDB3)

Sign In for Pricing
View Details
Recombinant Human LIM domain-binding protein 3 (LDB3)
MBS1042732-03 1 mg (E-Coli)

Recombinant Human LIM domain-binding protein 3 (LDB3)

Sign In for Pricing
View Details
Recombinant Human LIM domain-binding protein 3 (LDB3)
MBS1042732-04 5x 1 mg (E-Coli)

Recombinant Human LIM domain-binding protein 3 (LDB3)

Sign In for Pricing
View Details