Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM207A Peptide - middle region

FAM207A Peptide - middle region

Product Specifications

Product Name Alternative

PRED56, C21orf70

UniProt

Q9NSI2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_478070.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ERRRRATVVVGDLHPLRDALPELLGLEAGSRRQARSRESNKPRPSELSRM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PMP2 activation kit by CRISPRa
GA103629 1 Kit

Human PMP2 activation kit by CRISPRa

Sign In for Pricing
View Details
2,4'-Dichlorodiphenyltrichloroethane
TRC-D434205-10MG 10 mg

2,4'-Dichlorodiphenyltrichloroethane

Sign In for Pricing
View Details
ViSafe Green Gel Stain (10000X in water), 500µl
SD0101 500 µL

ViSafe Green Gel Stain (10000X in water), 500µl

Sign In for Pricing
View Details
Thidiazuron-D5
TRC-T344277-1MG 1 mg

Thidiazuron-D5

Sign In for Pricing
View Details
Tofacitinib impurity L
TRC-T528015-2.5MG 2.5 mg

Tofacitinib impurity L

Sign In for Pricing
View Details
SNX12 (150-162) Goat Polyclonal Antibody
AP23838PU-N 50 µg

SNX12 (150-162) Goat Polyclonal Antibody

Sign In for Pricing
View Details