Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM207A Peptide - middle region

FAM207A Peptide - middle region

Product Specifications

Product Name Alternative

PRED56, C21orf70

UniProt

Q9NSI2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_478070.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ERRRRATVVVGDLHPLRDALPELLGLEAGSRRQARSRESNKPRPSELSRM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDE4A Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI8B7]
TA501207AM 100 µL

PDE4A Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI8B7]

Sign In for Pricing
View Details
Mouse Cdh13 activation kit by CRISPRa
GA200658 1 Kit

Mouse Cdh13 activation kit by CRISPRa

Sign In for Pricing
View Details
CCDC144A Human Gene Knockout Kit (CRISPR)
KN421755 1 Kit

CCDC144A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
mLLT1 Human Gene Knockout Kit (CRISPR)
KN416754 1 Kit

mLLT1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ANKRD45 Human Gene Knockout Kit (CRISPR)
KN416235 1 Kit

ANKRD45 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Colloidal Gold Conjugated Arachis hypogaea Lectin (Peanut) -PNA-,  15nm
GP-2301-15 1 mL

Colloidal Gold Conjugated Arachis hypogaea Lectin (Peanut) -PNA-, 15nm

Sign In for Pricing
View Details