Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ENDOD1 Peptide - middle region

ENDOD1 Peptide - middle region

Product Specifications

UniProt

O94919

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_055851.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KMKKILEVVNQIQDEERMVQSQKSSSPLSSTRSKRSTLLPPEASEGSSSF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human 5-Hydroxytryptamine Receptor 1A (5-HTR1A) ELISA Kit
YP-W15559-01 48 Tests

Human 5-Hydroxytryptamine Receptor 1A (5-HTR1A) ELISA Kit

Sign In for Pricing
View Details
Human 5-Hydroxytryptamine Receptor 1A (5-HTR1A) ELISA Kit
YP-W15559-02 96 Tests

Human 5-Hydroxytryptamine Receptor 1A (5-HTR1A) ELISA Kit

Sign In for Pricing
View Details
Recombinant Human CLK3 Protein (GST tag)
ARP6483-01 10 µg

Recombinant Human CLK3 Protein (GST tag)

Sign In for Pricing
View Details
Recombinant Human CLK3 Protein (GST tag)
ARP6483-02 50 µg

Recombinant Human CLK3 Protein (GST tag)

Sign In for Pricing
View Details
Recombinant Human CLK3 Protein (GST tag)
ARP6483-03 100 µg

Recombinant Human CLK3 Protein (GST tag)

Sign In for Pricing
View Details
Recombinant Human CLK3 Protein (GST tag)
ARP6483-04 1 mg

Recombinant Human CLK3 Protein (GST tag)

Sign In for Pricing
View Details