Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IQCE Peptide - middle region

IQCE Peptide - middle region

Product Specifications

Product Name Alternative

1700028P05Rik

UniProt

Q6IPM2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001274430.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: REKEDMYDEIIELKKSLHVQKSDVDLMRTKLRRLEEENSRKDRQIEQLLD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CRIP1 Rabbit Polyclonal Antibody (BF750)
orb2518469 100 µL

CRIP1 Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details
Ttc23l sgRNA CRISPR Lentivector (Mouse) (Target 3)
K4664504 1.0 µg DNA

Ttc23l sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
TIGA1 siRNA (h)
sc-91601 10 µM

TIGA1 siRNA (h)

Sign In for Pricing
View Details
Kif26b siRNA Oligos set (Rat)
25679176 3x 5 nmol

Kif26b siRNA Oligos set (Rat)

Sign In for Pricing
View Details
L-Acetylcarnitine (hydrochloride)
C3098-10000 10 g

L-Acetylcarnitine (hydrochloride)

Sign In for Pricing
View Details
SETP2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV748286 1.0 µg DNA

SETP2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details