What is the catalog number for IQCE Peptide - middle region?

The catalog number for IQCE Peptide - middle region is orb1998171.

What sizes are available for IQCE Peptide - middle region?

IQCE Peptide - middle region is available in the following size(s): 100 µg.

Is IQCE Peptide - middle region in stock?

IQCE Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

IQCE Peptide - middle region

Product Specifications

Product Name Alternative

1700028P05Rik

UniProt

Q6IPM2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001274430.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: REKEDMYDEIIELKKSLHVQKSDVDLMRTKLRRLEEENSRKDRQIEQLLD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MBS2558920-01 20 Tests

Anti-Human CD1a Monoclonal Antibody (AF647 Conjugated) [OKT-6]

Sign In for Pricing

View Details

MBS2558920-02 100 Tests

Anti-Human CD1a Monoclonal Antibody (AF647 Conjugated) [OKT-6]

Sign In for Pricing

View Details

MBS2558920-03 2x 100 Tests

Anti-Human CD1a Monoclonal Antibody (AF647 Conjugated) [OKT-6]

Sign In for Pricing

View Details

MBS2558920-04 10x 100 Tests

Anti-Human CD1a Monoclonal Antibody (AF647 Conjugated) [OKT-6]

Sign In for Pricing

View Details

E101743 1 Each

Pig CATK ELISA Kit

Sign In for Pricing

View Details

IN12228 1 Each

Niobium (V) Oxalate xHydrate

Sign In for Pricing

View Details