Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAPK8 Peptide - middle region

MAPK8 Peptide - middle region

Product Specifications

Product Name Alternative

JNK, JNK1, PRKM8, SAPK1, JNK-46, JNK1A2, SAPK1c, JNK21B1/2

UniProt

P45983

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001265476.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KMLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse IgG2a Isotype Control SAFIRE Purified
MBS697141-01 0.1 mg

Mouse IgG2a Isotype Control SAFIRE Purified

Sign In for Pricing
View Details
Mouse IgG2a Isotype Control SAFIRE Purified
MBS697141-02 5x 0.1 mg

Mouse IgG2a Isotype Control SAFIRE Purified

Sign In for Pricing
View Details
RCN2 Recombinant Protein (Mouse)
RP167402 100 µg

RCN2 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Ricin communis RCA60 (RCA II, Castor bean) (APC) discontinued
R2031-52-APC 100 µL

Ricin communis RCA60 (RCA II, Castor bean) (APC) discontinued

Sign In for Pricing
View Details
Human Family with Sequence Similarity 193, Member A (FAM193A) ELISA Kit
orb781336-01 48 Tests

Human Family with Sequence Similarity 193, Member A (FAM193A) ELISA Kit

Sign In for Pricing
View Details
Human Family with Sequence Similarity 193, Member A (FAM193A) ELISA Kit
orb781336-02 96 Tests

Human Family with Sequence Similarity 193, Member A (FAM193A) ELISA Kit

Sign In for Pricing
View Details