Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAPK8 Peptide - middle region

MAPK8 Peptide - middle region

Product Specifications

Product Name Alternative

JNK, JNK1, PRKM8, SAPK1, JNK-46, JNK1A2, SAPK1c, JNK21B1/2

UniProt

P45983

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001265476.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KMLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Fibroblast Growth Factor 23 (FGF23) Protein
abx656432-01 50 µg

Mouse Fibroblast Growth Factor 23 (FGF23) Protein

Sign In for Pricing
View Details
Mouse Fibroblast Growth Factor 23 (FGF23) Protein
abx656432-02 100 µg

Mouse Fibroblast Growth Factor 23 (FGF23) Protein

Sign In for Pricing
View Details
Mouse Fibroblast Growth Factor 23 (FGF23) Protein
abx656432-03 200 µg

Mouse Fibroblast Growth Factor 23 (FGF23) Protein

Sign In for Pricing
View Details
Mouse Fibroblast Growth Factor 23 (FGF23) Protein
abx656432-04 500 µg

Mouse Fibroblast Growth Factor 23 (FGF23) Protein

Sign In for Pricing
View Details
Mouse Fibroblast Growth Factor 23 (FGF23) Protein
abx656432-05 1 mg

Mouse Fibroblast Growth Factor 23 (FGF23) Protein

Sign In for Pricing
View Details
ALKBH6 Protein Vector (Human) (pPB-N-His)
PV001418 500 ng

ALKBH6 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details