Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POR Peptide - middle region

POR Peptide - middle region

Product Specifications

Product Name Alternative

CPR, CYPOR, P450R, 4933424M13Rik

UniProt

P37040

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_032924.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KVYTGEMGRLKSYENQKPPFDAKNPFLAAVTTNRKLNQGTERHLMHLELD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(S)-Perillaldehyde (92%)
TRC-E560003-500MG 500 mg

(S)-Perillaldehyde (92%)

Sign In for Pricing
View Details
VEGFA Rabbit Polyclonal Antibody
TA365856 100 µL

VEGFA Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Repulsive guidance molecule A Antibody
KC-26586-01 50 μL

Repulsive guidance molecule A Antibody

Sign In for Pricing
View Details
Repulsive guidance molecule A Antibody
KC-26586-02 100 µL

Repulsive guidance molecule A Antibody

Sign In for Pricing
View Details
Repulsive guidance molecule A Antibody
KC-26586-03 1 mL

Repulsive guidance molecule A Antibody

Sign In for Pricing
View Details
5Alpha-Androstane-3Beta,17Beta-diol-d3
TRC-A637527-5MG 5 mg

5Alpha-Androstane-3Beta,17Beta-diol-d3

Sign In for Pricing
View Details