Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POR Peptide - middle region

POR Peptide - middle region

Product Specifications

Product Name Alternative

CPR, CYPOR, P450R, 4933424M13Rik

UniProt

P37040

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_032924.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KVYTGEMGRLKSYENQKPPFDAKNPFLAAVTTNRKLNQGTERHLMHLELD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WDFY3 Antibody: RPE
SPC-666D-RPE 100 µg

WDFY3 Antibody: RPE

Sign In for Pricing
View Details
rac 4-(2,3-Dichlorophenyl)-3,4-dihydro-1(2H)-naphthalenone
TRC-D435703-50MG 50 mg

rac 4-(2,3-Dichlorophenyl)-3,4-dihydro-1(2H)-naphthalenone

Sign In for Pricing
View Details
Acp5 Mouse Gene Knockout Kit (CRISPR)
KN300746LP 1 Kit

Acp5 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human CCDC177 activation kit by CRISPRa
GA111283 1 Kit

Human CCDC177 activation kit by CRISPRa

Sign In for Pricing
View Details
Human ASB1 activation kit by CRISPRa
GA109932 1 Kit

Human ASB1 activation kit by CRISPRa

Sign In for Pricing
View Details
ARF1 (Golgi Apparatus Marker) (ARF1/2117), CF740 conjugate, 0.1mg/mL
BNC742117-500 1x 500 µL

ARF1 (Golgi Apparatus Marker) (ARF1/2117), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details