What is the catalog number for WARS Peptide - middle region?

The catalog number for WARS Peptide - middle region is orb1998163.

What sizes are available for WARS Peptide - middle region?

WARS Peptide - middle region is available in the following size(s): 100 µg.

Is WARS Peptide - middle region in stock?

WARS Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

WARS Peptide - middle region

Product Specifications

Product Name Alternative

WRS, TrpRS

UniProt

P32921

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001157786.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KKPFYLYTGRGPSSEAMHLGHLVPFIFTKWLQDVFNVPLVIQMSDDEKYL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MBS1039472 Inquire

Recombinant Burkholderia cenocepacia Large-conductance mechanosensitive channel (mscL)

Sign In for Pricing

View Details

AMM10881V 100 µL

EIF4EL3 (EIF4E2) Mouse Monoclonal Antibody [Clone ID: LBI1F2]

Sign In for Pricing

View Details

BGA15748 2.5 g

1- (2-Fluorophenyl) cyclobutane-1-carboxylic acid

Sign In for Pricing

View Details

MR215670A1V 250 µL

Mouse Dnaja3 (NM_023646) AAV Particle

Sign In for Pricing

View Details

MBS9411348-01 0.1 mL

SYPL1 Antibody

Sign In for Pricing

View Details

MBS9411348-02 5x 0.1 mL

SYPL1 Antibody

Sign In for Pricing

View Details