SELL Peptide - C-terminal region
SELL Peptide - C-terminal region
Product Specifications
Product Name Alternative
Lnhr, CD62L, Ly-22, Lyam1, Ly-m22, Lyam-1, LECAM-1, AI528707, L-selectin
UniProt
P18337
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_035476.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: NWSSPEPICQETNRSFSKIKEGDYNPLFIPVAVMVTAFSGLAFLIWLARR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TA386329 200 µg
EPCAM Rabbit Monoclonal Antibody [Clone ID: HEA125]
Sign In for Pricing
View Details GTR15263257 1 Vial
Lentiviral mouse Zfp128 shRNA (UAS) - Lentiviral mouse Zfp128 shRNA (UAS, RFP) plasmid
Sign In for Pricing
View Details 
044235-ML750 100 µL
ZNF436, NT (ZNF436, KIAA1710, Zinc finger protein 436) (MaxLight 750) discontinued
Sign In for Pricing
View Details 