Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MPO Peptide - middle region

MPO Peptide - middle region

Product Specifications

Product Name Alternative

MKIAA4033

UniProt

P11247

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_034954.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LNMQRSRDHGLPGYNAWRRFCGLPQPSTVGELGTVLKNLELARKLMAQYG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IVD Antibody
KC-36230-01 50 μL

IVD Antibody

Sign In for Pricing
View Details
IVD Antibody
KC-36230-02 100 µL

IVD Antibody

Sign In for Pricing
View Details
IVD Antibody
KC-36230-03 1 mL

IVD Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS504751 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
RAB27A (NM_183235) Human Recombinant Protein
TP319810 20 µg

RAB27A (NM_183235) Human Recombinant Protein

Sign In for Pricing
View Details
S100A1 (Melanoma Marker) (S100A1/1942), CF640R conjugate, 0.1mg/mL
BNC401942-100 1x 100 µL

S100A1 (Melanoma Marker) (S100A1/1942), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details