Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MPO Peptide - middle region

MPO Peptide - middle region

Product Specifications

Product Name Alternative

MKIAA4033

UniProt

P11247

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_034954.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LNMQRSRDHGLPGYNAWRRFCGLPQPSTVGELGTVLKNLELARKLMAQYG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NOS1 Antibody
KC-20983-01 50 μL

NOS1 Antibody

Sign In for Pricing
View Details
NOS1 Antibody
KC-20983-02 100 µL

NOS1 Antibody

Sign In for Pricing
View Details
NOS1 Antibody
KC-20983-03 1 mL

NOS1 Antibody

Sign In for Pricing
View Details
Dental Autoclave BADT-101
BADT-101 1 Unit

Dental Autoclave BADT-101

Sign In for Pricing
View Details
ReadiUse™ Preactivated PE-Cy7 Maleimide
2719-AAT 1 mg

ReadiUse™ Preactivated PE-Cy7 Maleimide

Sign In for Pricing
View Details
SNX12 (150-162) Goat Polyclonal Antibody
AP23838PU-N 50 µg

SNX12 (150-162) Goat Polyclonal Antibody

Sign In for Pricing
View Details