Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHIA1 Peptide - middle region

CHIA1 Peptide - middle region

Product Specifications

Product Name Alternative

YNL, Chia, AMCase, 2200003E03Rik

UniProt

Q91XA9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_075675.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: APFTTMVSTSQNRQTFITSVIKFLRQYGFDGLDLDWEYPGSRGSPPQDKH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ADCY1 (Adenylate Cyclase 1, Brain) CLIA Kit
E-CL-H0223-01 24 Tests

Human ADCY1 (Adenylate Cyclase 1, Brain) CLIA Kit

Sign In for Pricing
View Details
Human ADCY1 (Adenylate Cyclase 1, Brain) CLIA Kit
E-CL-H0223-02 48 Tests

Human ADCY1 (Adenylate Cyclase 1, Brain) CLIA Kit

Sign In for Pricing
View Details
Human ADCY1 (Adenylate Cyclase 1, Brain) CLIA Kit
E-CL-H0223-03 96 Tests

Human ADCY1 (Adenylate Cyclase 1, Brain) CLIA Kit

Sign In for Pricing
View Details
Recombinant Leukotriene A4 Hydrolase Antibody
RC-5235-01 50 μL

Recombinant Leukotriene A4 Hydrolase Antibody

Sign In for Pricing
View Details
Recombinant Leukotriene A4 Hydrolase Antibody
RC-5235-02 100 µL

Recombinant Leukotriene A4 Hydrolase Antibody

Sign In for Pricing
View Details
Recombinant Leukotriene A4 Hydrolase Antibody
RC-5235-03 1 mL

Recombinant Leukotriene A4 Hydrolase Antibody

Sign In for Pricing
View Details