Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHIA1 Peptide - middle region

CHIA1 Peptide - middle region

Product Specifications

Product Name Alternative

YNL, Chia, AMCase, 2200003E03Rik

UniProt

Q91XA9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_075675.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: APFTTMVSTSQNRQTFITSVIKFLRQYGFDGLDLDWEYPGSRGSPPQDKH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BAP1 (BRCA1 Associated Protein 1) (BAP1/2667), CF568 conjugate, 0.1mg/mL
BNC682667-500 1x 500 µL

BAP1 (BRCA1 Associated Protein 1) (BAP1/2667), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NPRL3 Human Gene Knockout Kit (CRISPR)
KN200905LP 1 Kit

NPRL3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Equilin
TRC-E592800-25MG 25 mg

Equilin

Sign In for Pricing
View Details
Frozen Tissue Blocks, Breast
CB623238 1 Block

Frozen Tissue Blocks, Breast

Sign In for Pricing
View Details
ABCB4 Rabbit Polyclonal Antibody
TA371752 100 µL

ABCB4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human ZNF362 activation kit by CRISPRa
GA115697 1 Kit

Human ZNF362 activation kit by CRISPRa

Sign In for Pricing
View Details