Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD38 Peptide - middle region

CD38 Peptide - middle region

Product Specifications

Product Name Alternative

I-19, ADPRC 1, Cd38-rs1

UniProt

P56528

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_031672.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QTIPCNKTLFWSKSKHLAHQYTWIQGKMFTLEDTLLGYIADDLRWCGDPS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Tartrate-Resistant Acid Phosphatase 5B, Tracp-5B Elisa Kit
EKC35711 96 Tests

Human Tartrate-Resistant Acid Phosphatase 5B, Tracp-5B Elisa Kit

Sign In for Pricing
View Details
2-Nitro-N-propylbenzene-1-sulfonamide
PDA84063-01 0.5 g

2-Nitro-N-propylbenzene-1-sulfonamide

Sign In for Pricing
View Details
2-Nitro-N-propylbenzene-1-sulfonamide
PDA84063-02 5 g

2-Nitro-N-propylbenzene-1-sulfonamide

Sign In for Pricing
View Details
Trcg1 CRISPR Activation Plasmid (m)
sc-436770-ACT 20 µg

Trcg1 CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
Recombinant Human CHST15 protein, His-tagged
CHST15-3487H 25 µg

Recombinant Human CHST15 protein, His-tagged

Sign In for Pricing
View Details
Klf9 Mouse siRNA Oligo Duplex (Locus ID 16601)
SR406840 1 Kit

Klf9 Mouse siRNA Oligo Duplex (Locus ID 16601)

Sign In for Pricing
View Details