What is the catalog number for CD38 Peptide - middle region?

The catalog number for CD38 Peptide - middle region is orb1998156.

What sizes are available for CD38 Peptide - middle region?

CD38 Peptide - middle region is available in the following size(s): 100 µg.

Is CD38 Peptide - middle region in stock?

CD38 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

CD38 Peptide - middle region

Product Specifications

Product Name Alternative

I-19, ADPRC 1, Cd38-rs1

UniProt

P56528

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_031672.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QTIPCNKTLFWSKSKHLAHQYTWIQGKMFTLEDTLLGYIADDLRWCGDPS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GTR10438308 96 Well

Porcine Nucleotide-binding oligomerization domain-containing protein 2

Sign In for Pricing

View Details

abx272139-01 200 µL

Enolase, Non Neuronal (NNE) Antibody (Biotin)

Sign In for Pricing

View Details

abx272139-02 1 mL

Enolase, Non Neuronal (NNE) Antibody (Biotin)

Sign In for Pricing

View Details

NBP3-06211V 0.1 mL

Rabbit Monoclonal Asialoglycoprotein Receptor 2 Antibody (002) [DyLight 405]

Sign In for Pricing

View Details

E45R18068N-50 50 µL

NPR1 Rabbit pAb

Sign In for Pricing

View Details

MBS6249283-01 0.1 mL

Reticular Fibroblasts and Reticular Fibers (Fibroblast Marker) (Biotin)

Sign In for Pricing

View Details