Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OSCAR Peptide - middle region

OSCAR Peptide - middle region

Product Specifications

Product Name Alternative

MOSCAR, mOSCAR-M1, mOSCAR-M2, mOSCAR-M3

UniProt

Q8V8T3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001277306.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ATPLQYIDSVQPWADFLLIGTHTPGTYCCYYHTPSAPYVLSQRSQPLVIS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human CHDH shRNA (UAS) - Lentiviral human CHDH shRNA (UAS, iRFP) plasmid
GTR15163024 1 Vial

Lentiviral human CHDH shRNA (UAS) - Lentiviral human CHDH shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Recombinant Positive regulator of RepFIC repA1 expression (repL)
MBS1042086-01 0.05 mg (E-Coli)

Recombinant Positive regulator of RepFIC repA1 expression (repL)

Sign In for Pricing
View Details
Recombinant Positive regulator of RepFIC repA1 expression (repL)
MBS1042086-02 0.2 mg (E-Coli)

Recombinant Positive regulator of RepFIC repA1 expression (repL)

Sign In for Pricing
View Details
Recombinant Positive regulator of RepFIC repA1 expression (repL)
MBS1042086-03 0.05 mg (Yeast)

Recombinant Positive regulator of RepFIC repA1 expression (repL)

Sign In for Pricing
View Details
Recombinant Positive regulator of RepFIC repA1 expression (repL)
MBS1042086-04 0.5 mg (E-Coli)

Recombinant Positive regulator of RepFIC repA1 expression (repL)

Sign In for Pricing
View Details
Recombinant Positive regulator of RepFIC repA1 expression (repL)
MBS1042086-05 0.05 mg (Baculovirus)

Recombinant Positive regulator of RepFIC repA1 expression (repL)

Sign In for Pricing
View Details