Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LEP Peptide - middle region

LEP Peptide - middle region

Product Specifications

Product Name Alternative

Ob, obese

UniProt

P41160

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_032519.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: WLWSYLSYVQAVPIQKVQDDTKTLIKTIVTRINDISHTQSVSAKQRVTGL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

S100A4 (Marker of Tumor Metastasis) (S100A4/2750R), CF594 conjugate, 0.1mg/mL
BNC942750-100 1x 100 µL

S100A4 (Marker of Tumor Metastasis) (S100A4/2750R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP90AB1 Rabbit Polyclonal Antibody
AP06176PU-N 100 µg

HSP90AB1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human LAIR2/CD306 Protein, Low Endotoxin
PKSH031381-01 5 µg

Recombinant Human LAIR2/CD306 Protein, Low Endotoxin

Sign In for Pricing
View Details
Recombinant Human LAIR2/CD306 Protein, Low Endotoxin
PKSH031381-02 10 µg

Recombinant Human LAIR2/CD306 Protein, Low Endotoxin

Sign In for Pricing
View Details
Human Signal peptide peptidase like 2B (SPPL2B) activation kit by CRISPRa
GA111278 1 Kit

Human Signal peptide peptidase like 2B (SPPL2B) activation kit by CRISPRa

Sign In for Pricing
View Details
Palladium(II) Acetylacetonate
TRC-P578015-1G 1 g

Palladium(II) Acetylacetonate

Sign In for Pricing
View Details