Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LEP Peptide - middle region

LEP Peptide - middle region

Product Specifications

Product Name Alternative

Ob, obese

UniProt

P41160

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_032519.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: WLWSYLSYVQAVPIQKVQDDTKTLIKTIVTRINDISHTQSVSAKQRVTGL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sh3bp5l Mouse Gene Knockout Kit (CRISPR)
KN515716 1 Kit

Sh3bp5l Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Benzyl 2-Ethylhexyl Phthalate
TRC-B410853-5G 5 g

Benzyl 2-Ethylhexyl Phthalate

Sign In for Pricing
View Details
RACK1 (NM_006098) Human Over-expression Lysate
LC401838 20 µg

RACK1 (NM_006098) Human Over-expression Lysate

Sign In for Pricing
View Details
B4GALT7 Human Gene Knockout Kit (CRISPR)
KN200258RB 1 Kit

B4GALT7 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TOX3 (TOX3/1123), 0.2mg/mL
BNUB1123-500 1x 500 µL

TOX3 (TOX3/1123), 0.2mg/mL

Sign In for Pricing
View Details
HSP70 Monoclonal Antibody
E-AB-22005-01 20 µL

HSP70 Monoclonal Antibody

Sign In for Pricing
View Details