Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NNT Peptide - middle region

NNT Peptide - middle region

Product Specifications

Product Name Alternative

AI323702, BB168308, 4930423F13Rik

UniProt

Q61941

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EVDLKESGEGQGGYAKEMSKEFIEAEMKLFAQQCKEVDILISTALIPGKK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DHFR Antibody
KC-14110-01 50 μL

DHFR Antibody

Sign In for Pricing
View Details
DHFR Antibody
KC-14110-02 100 µL

DHFR Antibody

Sign In for Pricing
View Details
DHFR Antibody
KC-14110-03 1 mL

DHFR Antibody

Sign In for Pricing
View Details
Neuromedin B (NMB) Human Gene Knockout Kit (CRISPR)
KN400705 1 Kit

Neuromedin B (NMB) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Nitric Acid (65%)
TRC-N481520-250ML 250 mL

Nitric Acid (65%)

Sign In for Pricing
View Details
2-Chlorobenzaldehyde Oxime
TRC-C364665-50G 50 g

2-Chlorobenzaldehyde Oxime

Sign In for Pricing
View Details