Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NNT Peptide - middle region

NNT Peptide - middle region

Product Specifications

Product Name Alternative

AI323702, BB168308, 4930423F13Rik

UniProt

Q61941

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EVDLKESGEGQGGYAKEMSKEFIEAEMKLFAQQCKEVDILISTALIPGKK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BATF2 (NM_138456) Human Recombinant Protein
TP760348 50 µg

BATF2 (NM_138456) Human Recombinant Protein

Sign In for Pricing
View Details
Human UPRT activation kit by CRISPRa
GA115344 1 Kit

Human UPRT activation kit by CRISPRa

Sign In for Pricing
View Details
6-Chloro-imidazo[2,1-b]thiazole-5-sulfonic Acid Amide
TRC-C383335-50MG 50 mg

6-Chloro-imidazo[2,1-b]thiazole-5-sulfonic Acid Amide

Sign In for Pricing
View Details
Human αFP (Alpha-Fetoprotein) ELISA Kit
E-EL-H0070-01 24 Tests

Human αFP (Alpha-Fetoprotein) ELISA Kit

Sign In for Pricing
View Details
Human αFP (Alpha-Fetoprotein) ELISA Kit
E-EL-H0070-02 48 Tests

Human αFP (Alpha-Fetoprotein) ELISA Kit

Sign In for Pricing
View Details
Human αFP (Alpha-Fetoprotein) ELISA Kit
E-EL-H0070-03 96 Tests

Human αFP (Alpha-Fetoprotein) ELISA Kit

Sign In for Pricing
View Details